An
Email with the Subject "Fw: PLEASE FEEL FREE TO CONTACT" was
received in one of Scamdex's honeypot email accounts on Wed, 24 Sep 2008 06:20:57 -0700
and has been classified as a Generic Scam Email.
The sender shows as minerva zarza <avrenim70@yahoo.com>.
The email address was probably spoofed. Do not reply to or contact any persons or organizations referenced in
this email, or follow any URLs as you may expose yourself to scammers and, at the very least, you will be
added to their email address lists for spam purposes.
Scam TagCloud
lagosnigeriainheritance 234 8055755embassyforeignwestern contactwinclaimpaymentpaidmailavrenim70@yahoo.com will yahoo.com(committee chairman)dear mr. philip bryant, mr. jeffery peterson, mr. macanthony tosel, mr. george ellis mr. donald vann,
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email.
Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate investigating or law enforcement agencies on request.
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
--- On Wed, 24/9/08, US EMBASSY <unitedembassyy@ymail.com> wrote:
New Email names for you!
Get the Email name you've always wanted on the new @ymail and @rocketmail.
Hurry before someone else does!
--- On Wed, 24/9/08, US EMBASSY <unitedembassyy@ymail.com> wrote: From: US EMBASSY <unitedembassyy@ymail.com> Subject: PLEASE FEEL FREE TO CONTACT To: Date: Wednesday, 24 September, 2008, 8:33 PM
US EMBASSY #4 WALTER CARRINGTON STREET VICTORIA ISLAND. LAGOS, NIGERIA.
Email: unitedembassyy@inMail24.com
Dear Sir/Madam.
I write to inform you that following a meeting with the US Embassy and Federal Republic of Nigeria, Federal Republic of Cote'dvoir and Federal Republic of Benin.The subject of discussion is why American citizens and the rest of the world who executed foreign contracts/Inheritance/Lotteries are either paid part payment or not paid at all. There are
series of complaints by the American citizens and other Western World that they have lost some amount of money in pursuit of their payments and this gave rise to the US Government setting up a Ten man committee to work with the US Embassy here in Lagos, Nigeria.
The primary objective of this committee is to strictly comply to enforce the payment of their original contract sum/Inheritance and Lotteries as the case may be.Members of the committee are Mr. Philip Bryant, Mr. Jeffery Peterson, Mr. Mac Anthony Tosel, Mr. George Ellis and Mr. Donald Vann, all the members of the committee are American citizens. Once your claim is verified by this committee and approved for payment and if the above countries Nigeria, Cote'dvoir and Republic of Benin fails to pay you within the stipulated seven days, the USA Government will pay the exact amount in question to you.
You are therefore directed to contact the US
Embassy Lagos, Nigeria the Head Quarters of the committee on + 234 8055755564
Email:unitedembassyy@inMail24.com
Thanks
Yours Faithfully
Mr. MacAnthonyTosel.. (Committee Chairman)
New Email names for you!
Get the Email name you've always wanted on the new @ymail and @rocketmail.
Hurry before someone else does!