An
Email with the Subject "from Prince Williams..dear Sir" was
received in one of Scamdex's honeypot email accounts on Thu, 05 Apr 2007 11:04:10 -0700
and has been classified as a Advance Fee Fraud/419 Scam Email.
The sender shows as "willy nile" <willynile29@hotmail.com>.
The email address was probably spoofed. Do not reply to or contact any persons or organizations referenced in
this email, or follow any URLs as you may expose yourself to scammers and, at the very least, you will be
added to their email address lists for spam purposes.
Scam TagCloud
killeddeathcharles taylorgolddiamondtrunkboxforeignattorneylawyerchecksafeclaimsclaimdepositedpartnerresponseurgentsentmailas a surprisesierra will securityboxesach(paragraph 7 of the will)dearhttp://search.msn.com/
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email.
Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate investigating or law enforcement agencies on request.
EEEEEstdClass Object
(
[return-path:] =>
[envelope-to:] => submitted@scamdex.com
[delivery-date:] => Thu, 05 Apr 2007 11:04:10 -0700
[received:] => Array
(
[0] => from [65.54.246.155] (helo=bay0-omc2-s19.bay0.hotmail.com)by bartok.o7e.net with esmtp (Exim 4.63)(envelope-from )id 1HZWJe-0000ir-8Dfor submitted@scamdex.com; Thu, 05 Apr 2007 11:04:10 -0700
[1] => from hotmail.com ([64.4.56.17]) by bay0-omc2-s19.bay0.hotmail.com with Microsoft SMTPSVC(6.0.3790.2668); Thu, 5 Apr 2007 11:04:07 -0700
[2] => from mail pickup service by hotmail.com with Microsoft SMTPSVC; Thu, 5 Apr 2007 11:04:07 -0700
[3] => from 64.4.56.244 by by101fd.bay101.hotmail.msn.com with HTTP;Thu, 05 Apr 2007 18:04:07 GMT
)
[x-originating-ip:] => [41.204.32.206]
[x-originating-email:] => [willynile29@hotmail.com]
[x-sender:] => willynile29@hotmail.com
[reply-to:] => princewilliams75@yahoo.com
[from:] => "willy nile"
[bcc:] =>
[subject:] => from Prince Williams..dear Sir
[date:] => Thu, 05 Apr 2007 18:04:07 +0000
[mime-version:] => 1.0
[content-type:] => text/plain; format=flowed
[x-originalarrivaltime:] => 05 Apr 2007 18:04:07.0772 (UTC) FILETIME=[CE02D1C0:01C777AC]
[message-id:] => REIDs3x1206928119.M441699P594V-S3X
[x-scamdex-scores:] => S:67 P:53 A:58 L:56 E:59 G:52
[x-scamdex-classtype:] => S
[x-scamdex-classscore:] => 67
[x-scamdex-totscore:] => 345
[x-scamdex-kw:] => box,check,citi,claim,claims,death,diamond,foreign,gold,inc.,killed,partner,response,safe,sent,service,taylor,trunk,trust,urgent
[x-scamdex-em:] => princewilliams75@yahoo.com,willynile29@hotmail.com
[x-scamdex-dir:] => E
[x-scamdex-id:] => E1206928119.M441699P594V
[x-scamdex-copyright:] => This Email is Copyright Scamdex.com 2009, Reproduction Prohibited
)
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
Dear Sir,
I am Prince Williams Greaves, Male 20yrs old from Sierra-Leone.
which of course represent the true original Will from my late father Dr.
rebels for sponsoring rivalry rebels leader Prince Johnson.
rich gold and diamond merchandise.
covering my late father’s wealth of two Trunk Boxes
indicated on the (Paragraph 7 of the WILL) which stipulates that I can only
Attorney/Affidavit of Change of titles of Trustee which of cause is referred
SECURITY COMPANY, this is the Security Company in Accra Ghana where my late
foreign trustee Partner? Can I trust you?
present you before my lawyer and the Security Company.
I am waiting for your urgent response.
Thank you,
Yours truly,
Prince Greaves Williams.
+233 2438 29241
_________________________________________________________________
Dear Sir,
I am Prince Williams Greaves, Male 20yrs old from Sierra-Leone.
It may comes to you as a surprise receiving the below attached File from me,
which of course represent the true original Will from my late father Dr.
Greaves Williams a Sierra-Lone citizen who was killed by Charles Taylor
rebels for sponsoring rivalry rebels leader Prince Johnson.
My late father before his assassination that leads to his death was a very
rich gold and diamond merchandise.
I am now the only legitimate surviving heir left to inherit this Will
covering my late father’s wealth of two Trunk Boxes
The only hindrances to my full claims of my late father’s wealth as
indicated on the (Paragraph 7 of the WILL) which stipulates that I can only
claim these wealth through the physical presentation of Power of
Attorney/Affidavit of Change of titles of Trustee which of cause is referred
to as my foreign partner, approved by my lawyer and witnessed by BROADWAY
SECURITY COMPANY, this is the Security Company in Accra Ghana where my late
father deposited these wealth for security safety keeping purpose.
My question to you now is, can I present you to this Security Company as my
foreign trustee Partner? Can I trust you?
If so kindly reply me urgent with your complete details in order for me to
present you before my lawyer and the Security Company.
I am waiting for your urgent response.
Thank you,
Yours truly,
Prince Greaves Williams.
+233 2438 29241
_________________________________________________________________
Don't just search. Find. Check out the new MSN Search!
http://search.msn.com/
